APrEST81318-100ul, PrEST Antigen COG6 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen COG6, Gene description: component of oligomeric golgi complex 6, Alternative Gene Names: COD2, KIAA1134, Antigen sequence: VQQHKPEQGSLANMPNLDSVTLKAAMVQFDRYLSAPDNLLIPQLNFLLSATVKEQIVKQSTELVCRAYGEVYAAVMNPINEYKDPENILHRSPQQVQTLL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen COG6, Gene description: component of oligomeric golgi complex 6, Alternative Gene Names: COD2, KIAA1134, Antigen sequence: VQQHKPEQGSLANMPNLDSVTLKAAMVQFDRYLSAPDNLLIPQLNFLLSATVKEQIVKQSTELVCRAYGEVYAAVMNPINEYKDPENILHRSPQQVQTLL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|