APrEST81281-100ul, PrEST Antigen SUPT20H Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SUPT20H, Gene description: suppressor of Ty 20 homolog (S. cerevisiae), Alternative Gene Names: bA421P11.4, C13orf19, FAM48A, P38IP, SPT20, Antigen sequence: DSETIRLPYEEGELLEYLDAEELPPILVDLLEKSQVNIFHCGCVIAEIRDYRQSSNMKSPGYQSRHILLRPTMQTLICDVHSITSDNHKWTQED, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SUPT20H, Gene description: suppressor of Ty 20 homolog (S. cerevisiae), Alternative Gene Names: bA421P11.4, C13orf19, FAM48A, P38IP, SPT20, Antigen sequence: DSETIRLPYEEGELLEYLDAEELPPILVDLLEKSQVNIFHCGCVIAEIRDYRQSSNMKSPGYQSRHILLRPTMQTLICDVHSITSDNHKWTQED, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|