APrEST81208-100ul, PrEST Antigen SMCO3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SMCO3, Gene description: single-pass membrane protein with coiled-coil domains 3, Alternative Gene Names: C12orf69, LOC440087, Antigen sequence: KELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVILGEATSAASAVAVKLVGSNVTTGIINKLV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SMCO3, Gene description: single-pass membrane protein with coiled-coil domains 3, Alternative Gene Names: C12orf69, LOC440087, Antigen sequence: KELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVILGEATSAASAVAVKLVGSNVTTGIINKLV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|