APrEST81046-100ul, PrEST Antigen LRRIQ1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen LRRIQ1, Gene description: leucine-rich repeats and IQ motif containing 1, Alternative Gene Names: FLJ12303, KIAA1801, Antigen sequence: ATPDFVPEPSPHDLPMDEHVLPDDADINFGYCEVEEKCRQSFEAWQEKQKELEDKEKQTLKAQRDREEKQFQEEEEKR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen LRRIQ1, Gene description: leucine-rich repeats and IQ motif containing 1, Alternative Gene Names: FLJ12303, KIAA1801, Antigen sequence: ATPDFVPEPSPHDLPMDEHVLPDDADINFGYCEVEEKCRQSFEAWQEKQKELEDKEKQTLKAQRDREEKQFQEEEEKR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|