APrEST80797-100ul, PrEST Antigen LRTOMT Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen LRTOMT, Gene description: leucine rich transmembrane and O-methyltransferase domain containing, Alternative Gene Names: COMT2, DFNB63, LRRC51, Antigen sequence: MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen LRTOMT, Gene description: leucine rich transmembrane and O-methyltransferase domain containing, Alternative Gene Names: COMT2, DFNB63, LRRC51, Antigen sequence: MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|