APrEST80713-100ul, PrEST Antigen VWCE Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen VWCE, Gene description: von Willebrand factor C and EGF domains, Alternative Gene Names: FLJ32009, URG11, VWC1, Antigen sequence: EKVRCEAACSHPIPSRDGGCCPSCTGCFHSGVVRAEGDVFSPPNENCTVCVCLAGNVSCISPECPSGPCQTPPQTDCCTCVPVRCYFHG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen VWCE, Gene description: von Willebrand factor C and EGF domains, Alternative Gene Names: FLJ32009, URG11, VWC1, Antigen sequence: EKVRCEAACSHPIPSRDGGCCPSCTGCFHSGVVRAEGDVFSPPNENCTVCVCLAGNVSCISPECPSGPCQTPPQTDCCTCVPVRCYFHG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|