APrEST80692-100ul, PrEST Antigen ST5 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ST5, Gene description: suppression of tumorigenicity 5, Alternative Gene Names: DENND2B, HTS1, p126, Antigen sequence: PSSPTENGTENQPKFGSKSTLEENAYEDIVGDLPKENPYEDVDLKSRRAGRKSQQLSENSLDSLHRMWSPQDRKYNSPPTQLSLKPNSQSLRSGNWSERK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ST5, Gene description: suppression of tumorigenicity 5, Alternative Gene Names: DENND2B, HTS1, p126, Antigen sequence: PSSPTENGTENQPKFGSKSTLEENAYEDIVGDLPKENPYEDVDLKSRRAGRKSQQLSENSLDSLHRMWSPQDRKYNSPPTQLSLKPNSQSLRSGNWSERK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|