APrEST80681-100ul, PrEST Antigen RAPSN Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen RAPSN, Gene description: receptor-associated protein of the synapse, Alternative Gene Names: CMS1D, CMS1E, RNF205, Antigen sequence: MECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQALLGVAKCWVARKALDKALDAIE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen RAPSN, Gene description: receptor-associated protein of the synapse, Alternative Gene Names: CMS1D, CMS1E, RNF205, Antigen sequence: MECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQALLGVAKCWVARKALDKALDAIE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|