APrEST80625-100ul, PrEST Antigen TIMM8B Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TIMM8B, Gene description: translocase of inner mitochondrial membrane 8 homolog B (yeast), Alternative Gene Names: DDP2, FLJ21744, MGC102866, MGC117373, TIM8B, Antigen sequence: LGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen TIMM8B, Gene description: translocase of inner mitochondrial membrane 8 homolog B (yeast), Alternative Gene Names: DDP2, FLJ21744, MGC102866, MGC117373, TIM8B, Antigen sequence: LGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|