APrEST80581-100ul, PrEST Antigen TIMM10 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TIMM10, Gene description: translocase of inner mitochondrial membrane 10 homolog (yeast), Alternative Gene Names: TIM10, TIM10A, Antigen sequence: MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen TIMM10, Gene description: translocase of inner mitochondrial membrane 10 homolog (yeast), Alternative Gene Names: TIM10, TIM10A, Antigen sequence: MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|