Limba
|
APrEST80470-100ul, PrEST Antigen KSR2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen KSR2, Gene description: kinase suppressor of ras 2, Alternative Gene Names: FLJ25965, Antigen sequence: LPASHYYKYKQQFIFPDVVPVPETPTRAPQVILHPVTSNPILEGNPLLQIEVEPTSENEEVHDEAEESEDDFEEMNLSLLS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen KSR2, Gene description: kinase suppressor of ras 2, Alternative Gene Names: FLJ25965, Antigen sequence: LPASHYYKYKQQFIFPDVVPVPETPTRAPQVILHPVTSNPILEGNPLLQIEVEPTSENEEVHDEAEESEDDFEEMNLSLLS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|