APrEST80443-100ul, PrEST Antigen LRIT2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen LRIT2, Gene description: leucine-rich repeat, immunoglobulin-like and transmembrane domains 2, Alternative Gene Names: AC022389.4, LRRC22, Antigen sequence: LVISLHVQPAQALHAPDSLSIPSEGNAYIDLRVVKQTVHGILLEWLAVADTSKEEWFTLYIASDEAFRKEVVHIGPGINTYAVDDLLPGTKYE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen LRIT2, Gene description: leucine-rich repeat, immunoglobulin-like and transmembrane domains 2, Alternative Gene Names: AC022389.4, LRRC22, Antigen sequence: LVISLHVQPAQALHAPDSLSIPSEGNAYIDLRVVKQTVHGILLEWLAVADTSKEEWFTLYIASDEAFRKEVVHIGPGINTYAVDDLLPGTKYE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|