APrEST80343-100ul, PrEST Antigen FAM175B Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen FAM175B, Gene description: family with sequence similarity 175, member B, Alternative Gene Names: ABRO1, Em:AC068896.4, KIAA0157, Antigen sequence: ASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAVGSSNYASTSAGLKYPGSGADLPPPQRAAGDSGEDS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen FAM175B, Gene description: family with sequence similarity 175, member B, Alternative Gene Names: ABRO1, Em:AC068896.4, KIAA0157, Antigen sequence: ASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAVGSSNYASTSAGLKYPGSGADLPPPQRAAGDSGEDS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|