APrEST80322-100ul, PrEST Antigen CFAP70 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CFAP70, Gene description: cilia and flagella associated protein 70, Alternative Gene Names: FLJ25765, Antigen sequence: AVVDLLPLLEGQSSFQTTVPLHPVQGSPLETPRSSAKQCSLEVKVLVAEPLLTTAQISGGNLLKVTLEAAYSVPESFIPTGPGQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen CFAP70, Gene description: cilia and flagella associated protein 70, Alternative Gene Names: FLJ25765, Antigen sequence: AVVDLLPLLEGQSSFQTTVPLHPVQGSPLETPRSSAKQCSLEVKVLVAEPLLTTAQISGGNLLKVTLEAAYSVPESFIPTGPGQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|