APrEST80043-100ul, PrEST Antigen JMY Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen JMY, Gene description: junction mediating and regulatory protein, p53 cofactor, Alternative Gene Names: FLJ37870, Antigen sequence: VSSVRIVSASGTVSEEIEVLEMVKEDEAPLALSDAEQPPPATELESPAEECSWAGLFSFQDLRAVHQQLCSVNSQLEPCLPVFPEEPSGMWTVLF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen JMY, Gene description: junction mediating and regulatory protein, p53 cofactor, Alternative Gene Names: FLJ37870, Antigen sequence: VSSVRIVSASGTVSEEIEVLEMVKEDEAPLALSDAEQPPPATELESPAEECSWAGLFSFQDLRAVHQQLCSVNSQLEPCLPVFPEEPSGMWTVLF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|