APrEST79815-100ul, PrEST Antigen WDFY3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen WDFY3, Gene description: WD repeat and FYVE domain containing 3, Alternative Gene Names: ALFY, KIAA0993, ZFYVE25, Antigen sequence: AWCTDSGSDDSRRWSDQLSLDEKDGFIFVNYSEGQTRAHLQGPLSHPHPNPIEVRNYSRLKPGYRWERQLVFRSKLTMH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen WDFY3, Gene description: WD repeat and FYVE domain containing 3, Alternative Gene Names: ALFY, KIAA0993, ZFYVE25, Antigen sequence: AWCTDSGSDDSRRWSDQLSLDEKDGFIFVNYSEGQTRAHLQGPLSHPHPNPIEVRNYSRLKPGYRWERQLVFRSKLTMH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|