APrEST79797-100ul, PrEST Antigen BANK1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen BANK1, Gene description: B-cell scaffold protein with ankyrin repeats 1, Alternative Gene Names: BANK, FLJ20706, Antigen sequence: RHGHKELKKIFEDFSIQEIDINNEQENDYEEDIASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen BANK1, Gene description: B-cell scaffold protein with ankyrin repeats 1, Alternative Gene Names: BANK, FLJ20706, Antigen sequence: RHGHKELKKIFEDFSIQEIDINNEQENDYEEDIASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|