APrEST79564-100ul, PrEST Antigen DAPP1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen DAPP1, Gene description: dual adaptor of phosphotyrosine and 3-phosphoinositides, Alternative Gene Names: BAM32, Antigen sequence: HRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen DAPP1, Gene description: dual adaptor of phosphotyrosine and 3-phosphoinositides, Alternative Gene Names: BAM32, Antigen sequence: HRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|