APrEST79547-100ul, PrEST Antigen SACM1L Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SACM1L, Gene description: SAC1 suppressor of actin mutations 1-like (yeast), Alternative Gene Names: KIAA0851, SAC1, Antigen sequence: VIINLINQKGSEKPLEQTFATMVSSLGSGMMRYIAFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDSAGQVVANQEGVFRS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SACM1L, Gene description: SAC1 suppressor of actin mutations 1-like (yeast), Alternative Gene Names: KIAA0851, SAC1, Antigen sequence: VIINLINQKGSEKPLEQTFATMVSSLGSGMMRYIAFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDSAGQVVANQEGVFRS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|