APrEST79466-100ul, PrEST Antigen FBXW12 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen FBXW12, Gene description: F-box and WD repeat domain containing 12, Alternative Gene Names: Fbw12, FBXO35, Antigen sequence: SPVQEFHFSNLVTLPQMHLAITMDWKKTIKVWNCQDRDALAVLPMPQPCYCMEAYLTKDGPFLMVGDAAGDIYTFTLPGLRDVSKVTAFQY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen FBXW12, Gene description: F-box and WD repeat domain containing 12, Alternative Gene Names: Fbw12, FBXO35, Antigen sequence: SPVQEFHFSNLVTLPQMHLAITMDWKKTIKVWNCQDRDALAVLPMPQPCYCMEAYLTKDGPFLMVGDAAGDIYTFTLPGLRDVSKVTAFQY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|