APrEST79437-100ul, PrEST Antigen STT3B Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen STT3B, Gene description: STT3B, subunit of the oligosaccharyltransferase complex (catalytic), Alternative Gene Names: FLJ90106, SIMP, STT3-B, Antigen sequence: NPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen STT3B, Gene description: STT3B, subunit of the oligosaccharyltransferase complex (catalytic), Alternative Gene Names: FLJ90106, SIMP, STT3-B, Antigen sequence: NPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|