APrEST79373-100ul, PrEST Antigen TAMM41 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TAMM41, Gene description: TAM41, mitochondrial translocator assembly and maintenance protein, homolog (S. cerevisiae), Alternative Gene Names: C3orf31, DKFZp434E0519, MGC16471, Antigen sequence: MALQTLQSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDDPVAWHSKNLKKNWSHYSFL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen TAMM41, Gene description: TAM41, mitochondrial translocator assembly and maintenance protein, homolog (S. cerevisiae), Alternative Gene Names: C3orf31, DKFZp434E0519, MGC16471, Antigen sequence: MALQTLQSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDDPVAWHSKNLKKNWSHYSFL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|