Limba
|
APrEST79197-100ul, PrEST Antigen APLF Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen APLF, Gene description: aprataxin and PNKP like factor, Alternative Gene Names: C2orf13, MGC47799, Antigen sequence: NKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPECPYGPSCYRKNPQHKIEYRHNTLPVRNV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen APLF, Gene description: aprataxin and PNKP like factor, Alternative Gene Names: C2orf13, MGC47799, Antigen sequence: NKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPECPYGPSCYRKNPQHKIEYRHNTLPVRNV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|