Limba
|
APrEST79167-100ul, PrEST Antigen MEMO1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen MEMO1, Gene description: mediator of cell motility 1, Alternative Gene Names: C2orf4, CGI-27, MEMO, Antigen sequence: FILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen MEMO1, Gene description: mediator of cell motility 1, Alternative Gene Names: C2orf4, CGI-27, MEMO, Antigen sequence: FILGPSHHVPLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|