APrEST79066-100ul, PrEST Antigen EPC2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen EPC2, Gene description: enhancer of polycomb homolog 2 (Drosophila), Alternative Gene Names: DKFZP566F2124, Antigen sequence: YATPATLHNGNHHKVQECKTKHPHHLSLKEEASDVVRQKKKYPKKPKAEALITSQQPTPETLPVINKSDIKQYDFHSSDEDEFPQVLS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen EPC2, Gene description: enhancer of polycomb homolog 2 (Drosophila), Alternative Gene Names: DKFZP566F2124, Antigen sequence: YATPATLHNGNHHKVQECKTKHPHHLSLKEEASDVVRQKKKYPKKPKAEALITSQQPTPETLPVINKSDIKQYDFHSSDEDEFPQVLS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|