APrEST79045-100ul, PrEST Antigen PSD4 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen PSD4, Gene description: pleckstrin and Sec7 domain containing 4, Alternative Gene Names: EFA6B, TIC, Antigen sequence: EESMFFSNPLFLASPCSENSASGECFSWGASDSHAGVRTGPESPATLEPPLPEDTVLWELESEPDLGDGAAISGHCTPPFPVPIYKPHSI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen PSD4, Gene description: pleckstrin and Sec7 domain containing 4, Alternative Gene Names: EFA6B, TIC, Antigen sequence: EESMFFSNPLFLASPCSENSASGECFSWGASDSHAGVRTGPESPATLEPPLPEDTVLWELESEPDLGDGAAISGHCTPPFPVPIYKPHSI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|