APrEST78964-100ul, PrEST Antigen STAM2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen STAM2, Gene description: signal transducing adaptor molecule (SH3 domain and ITAM motif) 2, Alternative Gene Names: Hbp, Antigen sequence: PAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen STAM2, Gene description: signal transducing adaptor molecule (SH3 domain and ITAM motif) 2, Alternative Gene Names: Hbp, Antigen sequence: PAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|