Limba
|
APrEST78911-100ul, PrEST Antigen SH3YL1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SH3YL1, Gene description: SH3 and SYLF domain containing 1, Alternative Gene Names: DKFZP586F1318, Ray, Antigen sequence: FTYCKSRGLFAGVSLEGSCLIERKETNRKFYCQDIRAYDILFGDTPRPAQAEDLYEILDSFTEKYENEG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen SH3YL1, Gene description: SH3 and SYLF domain containing 1, Alternative Gene Names: DKFZP586F1318, Ray, Antigen sequence: FTYCKSRGLFAGVSLEGSCLIERKETNRKFYCQDIRAYDILFGDTPRPAQAEDLYEILDSFTEKYENEG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|