APrEST78833-100ul, PrEST Antigen SPATC1L Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen SPATC1L, Gene description: spermatogenesis and centriole associated 1-like, Alternative Gene Names: C21orf56, Antigen sequence: NADLKKQVRLLKENQMLRRLLSQSCQEGGGHDLLPPRAHAYPEAGSPGSGVPDFGRFTSVADTPSQLQTSSLEDLLCSHAPLSSEDD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen SPATC1L, Gene description: spermatogenesis and centriole associated 1-like, Alternative Gene Names: C21orf56, Antigen sequence: NADLKKQVRLLKENQMLRRLLSQSCQEGGGHDLLPPRAHAYPEAGSPGSGVPDFGRFTSVADTPSQLQTSSLEDLLCSHAPLSSEDD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|