Limba
|
APrEST78823-100ul, PrEST Antigen CXADR Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CXADR, Gene description: coxsackie virus and adenovirus receptor, Alternative Gene Names: CAR, Antigen sequence: KEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen CXADR, Gene description: coxsackie virus and adenovirus receptor, Alternative Gene Names: CAR, Antigen sequence: KEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|