APrEST78807-100ul, PrEST Antigen APEH Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen APEH, Gene description: acylaminoacyl-peptide hydrolase, Alternative Gene Names: D3F15S2, D3S48E, DNF15S2, Antigen sequence: IDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen APEH, Gene description: acylaminoacyl-peptide hydrolase, Alternative Gene Names: D3F15S2, D3S48E, DNF15S2, Antigen sequence: IDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|