APrEST78778-100ul, PrEST Antigen ATP23 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ATP23, Gene description: ATP23 metallopeptidase and ATP synthase assembly factor homolog, Alternative Gene Names: KUB3, Antigen sequence: CEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ATP23, Gene description: ATP23 metallopeptidase and ATP synthase assembly factor homolog, Alternative Gene Names: KUB3, Antigen sequence: CEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|