APrEST78374-100ul, PrEST Antigen ZBTB8A Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ZBTB8A, Gene description: zinc finger and BTB domain containing 8A, Alternative Gene Names: BOZF1, FLJ90065, ZBTB8, ZNF916A, Antigen sequence: TFIKSSLDISEKEKDRYFSLSDKDANSNGVERSSFYSGGWQEGSSSPRSHLSPEQGTGIISGKSWNKYNYHPASQKNTQQP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen ZBTB8A, Gene description: zinc finger and BTB domain containing 8A, Alternative Gene Names: BOZF1, FLJ90065, ZBTB8, ZNF916A, Antigen sequence: TFIKSSLDISEKEKDRYFSLSDKDANSNGVERSSFYSGGWQEGSSSPRSHLSPEQGTGIISGKSWNKYNYHPASQKNTQQP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|