APrEST78278-100ul, PrEST Antigen TIMM17B Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TIMM17B, Gene description: translocase of inner mitochondrial membrane 17 homolog B (yeast), Alternative Gene Names: DXS9822, JM3, Antigen sequence: ILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen TIMM17B, Gene description: translocase of inner mitochondrial membrane 17 homolog B (yeast), Alternative Gene Names: DXS9822, JM3, Antigen sequence: ILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|