Limba
|
APrEST78268-100ul, PrEST Antigen VSIG1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen VSIG1, Gene description: V-set and immunoglobulin domain containing 1, Alternative Gene Names: MGC44287, Antigen sequence: EPKPTQEPAPEPAPGSEPMAVPDLDIELELEPETQSELEPEPEPEPESEPGVVVEPLSEDEKGVVK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen VSIG1, Gene description: V-set and immunoglobulin domain containing 1, Alternative Gene Names: MGC44287, Antigen sequence: EPKPTQEPAPEPAPGSEPMAVPDLDIELELEPETQSELEPEPEPEPESEPGVVVEPLSEDEKGVVK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|