APrEST78074-100ul, PrEST Antigen ID2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen ID2, Gene description: inhibitor of DNA binding 2, dominant negative helix-loop-helix protein, Alternative Gene Names: bHLHb26, GIG8, Antigen sequence: MEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen ID2, Gene description: inhibitor of DNA binding 2, dominant negative helix-loop-helix protein, Alternative Gene Names: bHLHb26, GIG8, Antigen sequence: MEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|