APrEST77717-100ul, PrEST Antigen EYA4 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen EYA4, Gene description: EYA transcriptional coactivator and phosphatase 4, Alternative Gene Names: CMD1J, DFNA10, Antigen sequence: QYAQYYSASTYGAYMTSNNTADGTPSSTSTYQLQESLPGLTNQPGEFDTMQSPSTPIKDLDERTCRSSGSKS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen EYA4, Gene description: EYA transcriptional coactivator and phosphatase 4, Alternative Gene Names: CMD1J, DFNA10, Antigen sequence: QYAQYYSASTYGAYMTSNNTADGTPSSTSTYQLQESLPGLTNQPGEFDTMQSPSTPIKDLDERTCRSSGSKS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|