APrEST77482-100ul, PrEST Antigen STAT2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen STAT2, Gene description: signal transducer and activator of transcription 2, 113kDa, Alternative Gene Names: STAT113, Antigen sequence: DPTQLAEMIFNLLLEEKRILIQAQRAQLEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQAKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen STAT2, Gene description: signal transducer and activator of transcription 2, 113kDa, Alternative Gene Names: STAT113, Antigen sequence: DPTQLAEMIFNLLLEEKRILIQAQRAQLEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQAKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|