APrEST77382-100ul, PrEST Antigen FAM120B Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen FAM120B, Gene description: family with sequence similarity 120B, Alternative Gene Names: CCPG, KIAA1838, PGCC1, Antigen sequence: DTEILKVARTHHVQAESYLVYNIMSSGEIECSNTLEDELDQALPSQAFIYRPIRQRVYSLLLEDCQDVTSTCLAVKEWFVYPGNPL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen FAM120B, Gene description: family with sequence similarity 120B, Alternative Gene Names: CCPG, KIAA1838, PGCC1, Antigen sequence: DTEILKVARTHHVQAESYLVYNIMSSGEIECSNTLEDELDQALPSQAFIYRPIRQRVYSLLLEDCQDVTSTCLAVKEWFVYPGNPL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|