APrEST77373-100ul, PrEST Antigen PHACTR2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen PHACTR2, Gene description: phosphatase and actin regulator 2, Alternative Gene Names: C6orf56, KIAA0680, Antigen sequence: SALDPSQLLWAEEPTNRTTLYSGTGLSVNRENAKCFTTKEELGKTVPQLLTPGLMGESSESFSASEDEGHREYQANDSDSDG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen PHACTR2, Gene description: phosphatase and actin regulator 2, Alternative Gene Names: C6orf56, KIAA0680, Antigen sequence: SALDPSQLLWAEEPTNRTTLYSGTGLSVNRENAKCFTTKEELGKTVPQLLTPGLMGESSESFSASEDEGHREYQANDSDSDG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|