APrEST77234-100ul, PrEST Antigen CFAP57 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CFAP57, Gene description: cilia and flagella associated protein 57, Alternative Gene Names: FLJ32000, Antigen sequence: LKLTKKVRPQEVSETEPSRDMLSTAPTARLNEQEETGRIIEMQRLEIQRLRDQIQEQEQVTGFHTLAGVRLPSLSNSEVDLEVKTN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen CFAP57, Gene description: cilia and flagella associated protein 57, Alternative Gene Names: FLJ32000, Antigen sequence: LKLTKKVRPQEVSETEPSRDMLSTAPTARLNEQEETGRIIEMQRLEIQRLRDQIQEQEQVTGFHTLAGVRLPSLSNSEVDLEVKTN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|