Limba
|
APrEST77111-100ul, PrEST Antigen RCC1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen RCC1, Gene description: regulator of chromosome condensation 1, Alternative Gene Names: CHC1, Antigen sequence: IPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen RCC1, Gene description: regulator of chromosome condensation 1, Alternative Gene Names: CHC1, Antigen sequence: IPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|