APrEST77058-100ul, PrEST Antigen GCSAML Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen GCSAML, Gene description: germinal center-associated, signaling and motility-like, Alternative Gene Names: C1orf150, FLJ44728, Antigen sequence: MGNYLLRKLSCLGENQKKPKKGNPDEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENENGSGSEEV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen GCSAML, Gene description: germinal center-associated, signaling and motility-like, Alternative Gene Names: C1orf150, FLJ44728, Antigen sequence: MGNYLLRKLSCLGENQKKPKKGNPDEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENENGSGSEEV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|