APrEST76914-100ul, PrEST Antigen CIART Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen CIART, Gene description: circadian associated repressor of transcription, Alternative Gene Names: BC017397, Antigen sequence: NTQGCTTEGDLLFAQKCKELQGFIPPLTDLLNGLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWFPQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen CIART, Gene description: circadian associated repressor of transcription, Alternative Gene Names: BC017397, Antigen sequence: NTQGCTTEGDLLFAQKCKELQGFIPPLTDLLNGLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWFPQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|