APrEST76902-100ul, PrEST Antigen EYA3 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen EYA3, Gene description: EYA transcriptional coactivator and phosphatase 3, Alternative Gene Names: DKFZp686C132, Antigen sequence: YGLPPFGALWPGMKPESGLIQTPSPSQHSVLTCTTGLTTSQPSPAHYSYPIQASSTNASLISTSSTIANIPAAAVASISNQDYPTYTI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen EYA3, Gene description: EYA transcriptional coactivator and phosphatase 3, Alternative Gene Names: DKFZp686C132, Antigen sequence: YGLPPFGALWPGMKPESGLIQTPSPSQHSVLTCTTGLTTSQPSPAHYSYPIQASSTNASLISTSSTIANIPAAAVASISNQDYPTYTI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|