APrEST76820-100ul, PrEST Antigen WDTC1 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen WDTC1, Gene description: WD and tetratricopeptide repeats 1, Alternative Gene Names: ADP, DCAF9, KIAA1037, Antigen sequence: LRENSKHSEVLIDLTEYCGQLVEAKCLTVNPQDNNCLAVGASGPFVRLYDIRMIHNHRKSMKQSPSAGVHTFCDRQKPLPDGAAQYYVAGHLPVKLPDYNNRLR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen WDTC1, Gene description: WD and tetratricopeptide repeats 1, Alternative Gene Names: ADP, DCAF9, KIAA1037, Antigen sequence: LRENSKHSEVLIDLTEYCGQLVEAKCLTVNPQDNNCLAVGASGPFVRLYDIRMIHNHRKSMKQSPSAGVHTFCDRQKPLPDGAAQYYVAGHLPVKLPDYNNRLR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|