APrEST76747-100ul, PrEST Antigen MMACHC Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen MMACHC, Gene description: methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria, Alternative Gene Names: cblC, DKFZP564I122, Antigen sequence: MEPKVAELKQKIEDTLCPFGFEVYPFQVAWYNELLPPAFHLPLPGPTLAFLVLSTPAMFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen MMACHC, Gene description: methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria, Alternative Gene Names: cblC, DKFZP564I122, Antigen sequence: MEPKVAELKQKIEDTLCPFGFEVYPFQVAWYNELLPPAFHLPLPGPTLAFLVLSTPAMFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|