Limba
|
APrEST76744-100ul, PrEST Antigen HAPLN2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen HAPLN2, Gene description: hyaluronan and proteoglycan link protein 2, Alternative Gene Names: Bral1, Antigen sequence: DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Price | 1.448,00 RON (preturile sunt fara TVA) |
|---|---|
| Description |
PrEST Antigen HAPLN2, Gene description: hyaluronan and proteoglycan link protein 2, Alternative Gene Names: Bral1, Antigen sequence: DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|