APrEST76582-100ul, PrEST Antigen TCEANC2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen TCEANC2, Gene description: transcription elongation factor A (SII) N-terminal and central domain containing 2, Alternative Gene Names: C1orf83, FLJ32112, Antigen sequence: TMLELPDQTKENLVEALQELKKKIPSREVLKSTRIGHTVNKMRKHSDSEVASLAREVYTEWKTFTEKHSNRPSIEV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen TCEANC2, Gene description: transcription elongation factor A (SII) N-terminal and central domain containing 2, Alternative Gene Names: C1orf83, FLJ32112, Antigen sequence: TMLELPDQTKENLVEALQELKKKIPSREVLKSTRIGHTVNKMRKHSDSEVASLAREVYTEWKTFTEKHSNRPSIEV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|