APrEST76580-100ul, PrEST Antigen RALGPS2 Antibody 100ul
https://www.atlasantibodies.com/products/prest-control-antigens/
PrEST Antigen RALGPS2, Gene description: Ral GEF with PH domain and SH3 binding motif 2, Alternative Gene Names: FLJ10244, FLJ25604, KIAA0351, Antigen sequence: VEDDNYKLSLKIEPGTSTPRSAASREDLVGPEVGASPQSGRKSVAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMNTAEFKSATFPNAGP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Price | 1.448,00 RON (preturile sunt fara TVA) |
---|---|
Description |
PrEST Antigen RALGPS2, Gene description: Ral GEF with PH domain and SH3 binding motif 2, Alternative Gene Names: FLJ10244, FLJ25604, KIAA0351, Antigen sequence: VEDDNYKLSLKIEPGTSTPRSAASREDLVGPEVGASPQSGRKSVAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMNTAEFKSATFPNAGP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
|